Queen's University Belfast
Identification and bio-evaluation of an antimicrobial peptide from the skin secretion of Phyllomedusa tarsius
Abstract
dc:description.abstractAntimicrobial peptides (AMPs), as a large classification of biologically active peptides, showed a broad-spectrum efficacy against various microorganisms. Although the antibacterial activity of these peptides already has been proven, studies have shown that antibacterial peptides can also play other roles. In this study, a novel peptide was identified from the skin secretion of the tree frog from South America, Phyllomedusa tarsius. After mRNA was isolated from skin secretions, a cDNA library was established and subjected to molecular cloning technology. The sequence of an active peptide, QUB-3128 (GLFKTLIKGAGKMLGHVAKQFLGSQGQPES) was deduced from the cloned cDNA encoding a dermaseptin precursor. Subsequently, this peptide was synthesised by solid-phase synthesis, and the purified synthetic form was used for biological assays. Results showed that this peptide possessed ideal inhibitory effects on S. aureus (NCTC 10788), E. coli (ATCC 8739) and C. albicans (ATCC 10231), with MIC concentrations of 4 µM, 8 µM and 128 µM, respectively. Also, it showed antiproliferative activities against two human cancer cell lines, H838 and PC-3, where the IC50 values against both were approximately 2 µM. However, this peptide demonstrated observable haemolytic effects at higher peptide concentrations (≥ 128 µM) on horse blood cells. Altogether, this dermaseptin peptide with antimicrobial and antiproliferative activity could be an ideal candidate for developing new antibacterial and anticancer reagents.
Degree
thesis:*- Name dc:type.qualificationname
- Master of Philosophy
- Level dc:type.qualificationlevel
- Masters Thesis
- Grantor dc:publisher.institution
- Queen's University Belfast
- Year dc:date.issued
- 2020
Author and committee
dc:creator, dc:contributor.*- Author dc:creator
-
- Gu, Xuyuan
- Advisors dc:contributor.advisor
-
- Zhou, Mei
- Wang, Lei
- Chen, Tianbao
Subjects
dc:subject × 6Rights
- Language dc:language
- eng
Identifiers
dc:identifier.*- Identifier
- oai:pure.qub.ac.uk/portal:studenttheses/0c7c00cf-a48c-443d-b301-a21724f372df
- OAI identifier oai:identifier
- oai:pure.qub.ac.uk/portal:studenttheses/0c7c00cf-a48c-443d-b301-a21724f372df